TRDD3, Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse Polyclonal Antibody

Brand:  Abnova H00028523-B01P.50ug

Product Code. 16188852

Description

Sequence: MLFSSLLCVFVAFSYSGSSVAQKVTQAQSSVSMPVRKEVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGESFLPFRGNFHYTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTRSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTVAVNFLLTAKLFFL

Specifications

• Antigen: TRDD3
• Classification: Polyclonal
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC022317
• Gene Symbols: TRDD3
• Immunogen: TRDD3 (AAH22317, 1 a.a. ∼ 296 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 28523
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Gene: T cell receptor delta diversity 3
• Gene Alias: TCRD
• Host Species: Mouse
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody