TMEM115, Mouse anti-Human, Clone: 3D4, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00011070-M01.100ug

Product Code. 16106122

Description

Sequence: MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL

Specifications

• Antigen: TMEM115
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: transmembrane protein 115
• Gene Alias: PL6
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3D4
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC017367
• Gene Symbols: TMEM115
• Immunogen: PL6 (AAH17367, 1 a.a. ∼ 351 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 11070
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ