missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ S100A11 (Human) Recombinant Protein

Human S100A11 partial ORF ( AAH14354.1, 10 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00006282-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16004715

  • £275.34 / 10µg

Estimated Shipment
02-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
Specifications

Specifications

AAH14354.1
S100 calcium binding protein A11
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
S100A11
GST
6282
Wheat germ expression system
10 μg
MLN70, S100C
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Documents