missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit MMP 9 Protein

A cDNA sequence encoding the MMP 9 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12707-0.1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15961289

  • £1108.23 / 100µg
Estimated Shipment: 10-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

100008993
Greater than 85.0% as determined by SDS-PAGE.
Research Use Only
MMP9
Rabbit
His
The MMP-9 solution (0.3 mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
MMP 9 Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
Insect
APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSSCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPEDENLYFQGLEEQKLISEEDLNSAVDHHHHHH
Videos
SDS
Documents
Certificates
Special Offers

Special Offers