missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit IL 8 Protein

A cDNA sequence encoding the IL 8 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12400-5ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15960299

  • £98.39 / 5µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

100009129
Greater than 90% as determined by SDS-PAGE.
Research Use Only
CXCL8
Rabbit
His
The IL-8 solution (1 mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
IL 8 Protein
5 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES
Videos
SDS
Documents
Certificates
Special Offers

Special Offers