missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit GHBP Protein

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10642-20ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15954498

  • £151.37 / 20µg
Estimated Shipment: 10-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

GHBP Protein
20 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Greater than 98.0% as determined bySDS-PAGE.
Research Use Only
Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Rabbit
Untagged
The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.
Videos
SDS
Documents
Certificates
Special Offers

Special Offers