missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rabbit GHBP Protein

A cDNA sequence encoding the GHBP was constructed and used to recombinantly synthesize the protein.

£99.15 - £3710.00

Name	GHBP Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Biological Activity	Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Product Type	Recombinant Protein

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15964498 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10642-5UG	5 μg	£99.15 5µg View alternative products Save Up to »	Estimated Shipment: 29-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15954498 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10642-20UG	20 μg	£155.00 20µg View alternative products Save Up to »	Estimated Shipment: 29-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15944498 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10642-1MG	1 mg	£3710.00 1mg View alternative products Save Up to »	Estimated Shipment: 29-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	GHBP Protein
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Product Type	Recombinant Protein
Species	E. coli
Sequence	AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
Purity or Quality Grade	Greater than 98.0% as determined bySDS-PAGE.

Regulatory Status	Research Use Only
Biological Activity	Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
Cross Reactivity	Rabbit
Protein Tag	Untagged
Buffer	The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1 mg/ml) solution with 0.0045mM NaHCO3.

Description