missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP11985-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15959008

  • £662.78 / 500µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Gliadin Gamma Wheat Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
His
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.
Protein is >90% pure.
Research Use Only
Recombinant Protein
E. coli
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Videos
SDS
Documents
Certificates
Special Offers

Special Offers