missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Gliadin Gamma Wheat Protein

A cDNA sequence encoding the Gliadin Gamma Wheat was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP11985-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15949008

  • £1298.50 / 1mg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Gliadin Gamma Wheat Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Other
His
Gliadin Gamma protein solution (1 mg/ml) in 10mM Tris-HCl pH 7.2.
Protein is >90% pure.
Research Use Only
Recombinant Protein
E. coli
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Videos
SDS
Documents
Certificates
Special Offers

Special Offers