missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Der P1 Protein

A cDNA sequence encoding the Der P1 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP11657-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15967938

  • £662.78 / 500µg
Estimated Shipment: 12-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Der P1 Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH
Protein is >95% pure as determined by 10% SDS-PAGE (coomassie staining).
Research Use Only
DERP1
Other
His
(1 mg/ml) 60mM NaCl, 50mM Tris-HCl pH 8.0 and 1.2M Urea.
Videos
SDS
Documents
Certificates
Special Offers

Special Offers