missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Mouse IL17E Protein
A cDNA sequence encoding the IL17E was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP10725-25ug
Additional Details : Weight : 0.01000kg
Specifications
| 140806 | |
| 25 μg | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml. | |
| Mouse | |
| Untagged | |
| IL17E was lyophilized from a concentrated (1 mg/ml) solution containing no additives. |
| IL17E Protein | |
| Research Use Only | |
| Il25 | |
| Recombinant Protein | |
| E. coli | |
| VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA | |
| Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |