missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse IL 17 A/F Protein

A cDNA sequence encoding the IL 17 A/F was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12392-0.1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15950269

  • £992.54 / 100µg
Estimated Shipment: 14-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

IL 17 A/F Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Mouse
Untagged
Lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Greater than 97.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Videos
SDS
Documents
Certificates
Special Offers

Special Offers