missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human SYK Protein

A cDNA sequence encoding the SYK was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13656-2ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15954289

  • £98.39 / 2µg
Estimated Shipment: 14-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

6850
Greater than 85.0% as determined by SDS-PAGE.
Research Use Only
SYK
Human
Flag Tag
SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
SYK Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFG GRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN
Videos
SDS
Documents
Certificates
Special Offers

Special Offers