missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human RAC1 Protein

A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13249-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15962969

  • £98.39 / 10µg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

RAC1 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL
Videos
SDS
Documents
Certificates
Special Offers

Special Offers