missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human RAC1 Protein
A cDNA sequence encoding the RAC1 was constructed and used to recombinantly synthesize the protein.
£99.15 - £1985.00
Specifications
Name | RAC1 Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Product Type | Recombinant Protein |
Cross Reactivity | Human |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15962969
|
enQuireBio™
QP13249-10UG |
10 μg |
£99.15
10µg |
Estimated Shipment: 03-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15982969
|
enQuireBio™
QP13249-50UG |
50 μg |
£155.00
50µg |
Estimated Shipment: 03-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15972969
|
enQuireBio™
QP13249-1MG |
1 mg |
£1985.00
1mg |
Estimated Shipment: 03-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
RAC1 Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Human | |
Untagged | |
The protein solution contains 20mM Tris-HCl pH 7.5, 2mM EDTA and 1mM DTT. |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL | |
Greater than 95.0% as determined by SDS-PAGE. |