missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PROC Protein

A cDNA sequence encoding the PROC was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP13151-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15962659

  • £151.37 / 10µg
Estimated Shipment: 14-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

5624
Greater than 80.0% as determined by SDS-PAGE.
Research Use Only
PROC
Human
His
PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
PROC Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
HEK 293
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIK EVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGW GYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACE GDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAP QKSWAPEFHHHHHHHHThe first 32 amino acids are predicted as signal peptide
Videos
SDS
Documents
Certificates
Special Offers

Special Offers