missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PRL R Protein

A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.

£99.15 - £3710.00

Name	PRL R Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Biological Activity	Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Product Type	Recombinant Protein

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15945348 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10846-5UG	5 μg	£99.15 5µg View alternative products Save Up to »	Estimated Shipment: 30-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15935348 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10846-20UG	20 μg	£155.00 20µg View alternative products Save Up to »	Estimated Shipment: 30-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15925348 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP10846-1MG	1 mg	£3710.00 1mg View alternative products Save Up to »	Estimated Shipment: 30-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	PRL R Protein
Endotoxin Concentration	< 1.0 EU per ug protein as determined by the LAL method.
Product Type	Recombinant Protein
Species	E. coli
Sequence	AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Purity or Quality Grade	Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.

Regulatory Status	Research Use Only
Biological Activity	Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Cross Reactivity	Human
Protein Tag	Untagged
Buffer	The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.

Description