missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human PRL R Protein

A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP10846-5ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15945348

  • £98.39 / 5µg
Estimated Shipment: 12-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

PRL R Protein
5 μg
< 1.0 EU per ug protein as determined by the LAL method.
Recombinant Protein
E. coli
AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Research Use Only
Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Human
Untagged
The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3.
Videos
SDS
Documents
Certificates
Special Offers

Special Offers