missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12946-EC-5ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15942039

  • £87.35 / 5µg

Estimated Shipment
26-04-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

1029
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
CDKN2A
Human
Untagged
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
p16-INK4a Protein
5 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Videos
SDS
Documents