missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human p16-INK4a Protein
A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.
£99.15 - £3875.00
Specifications
Gene ID (Entrez) | 1029 |
---|---|
Name | p16-INK4a Protein |
Regulatory Status | Research Use Only |
Endotoxin Concentration | Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. |
Gene Symbol | CDKN2A |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15942039
|
enQuireBio™
QP12946-EC-5UG |
5 μg |
£99.15
5µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15922039
|
enQuireBio™
QP12946-20UG |
20 μg |
£155.00
20µg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15932039
|
enQuireBio™
QP12946-EC-1MG |
1 mg |
£3875.00
1mg |
Estimated Shipment: 05-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
1029 | |
Research Use Only | |
CDKN2A | |
Human | |
Untagged | |
CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4. |
p16-INK4a Protein | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
Recombinant Protein | |
E. coli | |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD | |
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |