missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human HGF B Protein

A cDNA sequence encoding the HGF B was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12230-10ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15959768

  • £151.37 / 10µg
Estimated Shipment: 13-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HGF B Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Videos
SDS
Documents
Certificates
Special Offers

Special Offers