missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human GNLY Protein

A cDNA sequence encoding the GNLY was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12021-2ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15959118

  • £98.39 / 2µg
Estimated Shipment: 12-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

GNLY Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
His
The Granulysin protein was lyophilized from a concentrated (1 mg/ml) solution containing no additives.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH
Videos
SDS
Documents
Certificates
Special Offers

Special Offers