missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human C3c Protein

A cDNA sequence encoding the C3c was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP11238-10mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15946578

  • £1216.35 / 10mg
Estimated Shipment: 13-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

C3c Protein
10 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Human
Untagged
The Human Complement C3c was lyophilized in a sodium phosphate buffer, pH 7.2, containing 0.15M NaCl.
Greater than 96.0%.
Research Use Only
Recombinant Protein
Native Protein
C3c Beta chain (23-667)SPMYSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKGLEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEVVLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVGNSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRLLKC3c alpha chain fragment 1 (749-954)SNLDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGRC3c alpha chain fragment 2 (1321-1663)SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Videos
SDS
Documents
Certificates
Special Offers

Special Offers