Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Artikelnummer. 18735843

missing translation for 'mfr': Novus Biologicals™ NBP254789100UG

Beschreibung

Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Spezifikation

• For Use With (Application): In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
• Formulation: PBS
• Gene ID (Entrez): 6622
• Name: Human alpha-Synuclein Aggregate Protein
• Purification Method: >95% pure by SDS-PAGE
• Quantity: 100 μg
• Source: E.Coli
• Immunogen: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
• Storage Requirements: Store at −80°C. Avoid freeze-thaw cycles.
• Regulatory Status: RUO
• Gene Alias: alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
• Gene Symbol: SNCA
• Biological Activity: Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
• Product Type: Recombinant Protein
• Conjugate: Unconjugated
• Cross Reactivity: Human
• Recombinant: Recombinant