missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HSV HSV-2 gB Protein

A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12342-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15940119

  • £1165.00 / 1mg

Estimated Shipment
30-04-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HSV HSV-2 gB Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HSV
His
10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Protein is >90% pure as determined by SDS PAGE.
Research Use Only
Recombinant Protein
E. coli
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH
Videos
SDS
Documents