missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HSV HSV-2 gB Protein
A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12342-1mg
Additional Details : Weight : 0.01000kg
Specifications
HSV HSV-2 gB Protein | |
1 mg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HSV | |
His | |
10mM Phosphate buffer pH 7.6 and 75mM NaCl. |
Protein is >90% pure as determined by SDS PAGE. | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH |