missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HPV HPV 6 Protein

A cDNA sequence encoding the HPV 6 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12309-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15970009

  • £662.78 / 500µg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

HPV HPV 6 Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HPV
GST
PBS and 3M Urea.
Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
VDVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAK
Videos
SDS
Documents
Certificates
Special Offers

Special Offers