missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12178-B-1mg

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15949608

  • £1654.24 / 1mg
Estimated Shipment: 04-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Specifications

Specifications

Hepatitis C HCV NS4 a+b Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis C
Biotin
(1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Research Use Only
Recombinant Protein
E. coli
1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Videos
SDS
Documents
Certificates
Special Offers

Special Offers