enQuireBio™ Recombinant Hepatitis B HBsAg preS1 Protein

A cDNA sequence encoding the HBsAg preS1 was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12128-10ug

Product Code. 15969458

Specifications

• Name: Hepatitis B HBsAg preS1 Protein
• Regulatory Status: Research Use Only
• Product Type: Recombinant Protein
• Species: E. coli
• Sequence: MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
• Purity or Quality Grade: HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).

• Quantity: 10 μg
• Endotoxin Concentration: Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
• Cross Reactivity: Hepatitis B
• Protein Tag: Untagged
• Buffer: HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4, and 50mM NaCl.