TRIP4 Rabbit anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant TRIP4.

Brand:  Abnova PAB20890.100uL

Product Code. 16103880

Description

Sequence: ILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKLERETLQKREEELRELRHASRLSKKVTIDFAGRKILEEENSLA

Specifications

• Antigen: TRIP4
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant TRIP4.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: HsT17391
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 9325
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry (PFA fixed), Western Blot
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:50-1:200) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
• Gene: TRIP4
• Gene Symbols: TRIP4
• Immunogen: Recombinant protein corresponding to amino acids of human TRIP4.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Liquid

For Research Use Only