INTS10, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant INTS10.

Brand:  Abnova PAB23514.100uL

Product Code. 16106030

Description

INTS10 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM

Sequence: KGRRSYGDILHRMKDLCRYMNNFDSEAHAKYKNQVVYSTMLVFFKNAFQYVNSIQPSLFQGPNAPSQVPLVLLEDVSNVYGD

Specifications

• Antigen: INTS10
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against recombinant INTS10.
• Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
• Gene Alias: C8orf35/FLJ10569/INT10
• Host Species: Rabbit
• Purification Method: Antigen affinity purification
• Regulatory Status: RUO
• Gene ID (Entrez): 55174
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Formalin/Paraffin)
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry (1:1000-1:2500) The optimal working dilution should be determined by the end user.
• Gene: INTS10
• Gene Symbols: INTS10
• Immunogen: Recombinant protein corresponding to amino acids of human INTS10.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

For Research Use Only