missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OTOS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | OTOS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
OTOS Polyclonal specifically detects OTOS in Mouse samples. It is validated for Western Blot.Specifications
| OTOS | |
| Polyclonal | |
| Rabbit | |
| NP_694754 | |
| 150677 | |
| The immunogen for this antibody is Otos - middle region. Peptide sequence YWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| OTOSP, otospiralin | |
| OTOS | |
| IgG | |
| 10 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title