missing translation for 'onlineSavingsMsg'
Learn More

SFPQ, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SFPQ.

Brand:  Abnova H00006421-A01.50uL

Additional Details : Weight : 0.00010kg

Product Code. 16155115

  • £187.00 / 50µL

Estimated Shipment
17-06-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ
Specifications

Specifications

SFPQ
Unconjugated
50% glycerol
NM_005066
POMP100|PSF
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SFPQ.
SFPQ
Antisera
SFPQ
SFPQ (NP_005057, 269 a.a. ∽ 361 a.a) partial recombinant protein with GST tag.
RUO
Primary
6421
Videos
Documents

For Research Use Only