MBTPS2, Mouse anti-Human, Clone: 1A3, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00051360-M01.100ug

Product Code. 16106886

Description

Sequence: ASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNFNKRLHTCLPARKAVEATQVCRTNKDCKKSSSSSFCIIPSLETHTRLIKVKHPPQIDMLYVGHPLHLH

Specifications

• Antigen: MBTPS2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: membrane-bound transcription factor peptidase, site 2
• Gene Alias: FLJ32174/S2P
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 1A3
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_015884
• Gene Symbols: MBTPS2
• Immunogen: MBTPS2 (NP_056968.1, 312 a.a. ∼ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 51360
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ