missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ JAG1 (Human) Recombinant Protein (Q01)
Human JAG1 partial ORF with GST-tag at N-terminal
£280.00 - £425.00
Specifications
Accession Number | NP_000205 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 182 |
Molecular Weight (g/mol) | 35.64 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16003605
|
Abnova™
H00000182-Q01.10UG |
10 ug |
£280.00
10µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16013605
|
Abnova™
H00000182-Q01.25UG |
25 ug |
£425.00
25µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.
- Theoretical MW: 35.64kDa
- Preparation Method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Best use within three months from the date of receipt of this protein
Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array
Specifications
NP_000205 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
35.64 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
JAG1 | |
Human | |
Recombinant | |
Solution |
Antibody Production, ELISA, Protein Array, Western Blot | |
182 | |
JAG1 (Human) Recombinant Protein (Q01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG | |
AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644 | |
JAG1 | |
Wheat Germ (in vitro) | |
GST |