missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM58 Partial ORF (NP_056246, 346 a.a. - 445 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00025893-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005385

  • £418.72 / 25µg

Estimated Shipment
06-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: HYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLR
Specifications

Specifications

NP_056246
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HYWEVLVGEGAEWGLGVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASPSVPLLQLESPRCIGIFLDYEAGEISFYNVTDGSYIYTFNQLFSGLLR
RUO
TRIM58
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
25893
TRIM58 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BIA2|DKFZp434C091
TRIM58
Yes
Videos
Documents