missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human STIP1 Partial ORF (AAH02987.1, 320 a.a. - 464 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010963-Q06.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005295

  • £275.34 / 10µg

Estimated Shipment
02-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: IHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEA
Specifications

Specifications

AAH02987.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41.58kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEA
RUO
STIP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10963
STIP1 (Human) Recombinant Protein (Q06)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOP|IEF-SSP-3521|P60|STI1|STI1L
STIP1
Yes
Videos
Documents