missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCNA Partial ORF (NP_002583, 152 a.a. - 261 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005111-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16004515

  • £418.72 / 25µg

Estimated Shipment
07-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Specifications

Specifications

NP_002583
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
RUO
PCNA
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5111
PCNA (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC8367
PCNA
Yes
Videos
Documents