Invitrogen™ Human DDB1 (aa 541-651) Control Fragment Recombinant Protein

Product Code. 30203448

Brand: Invitrogen™ RP107637

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA damage-binding protein from HeLa cells is associated with polypeptides of relative mass 124,000 (DDB1) and 41,000 (DDB2) as determined by SDS-polyacrylamide gels. To test whether the DNA-repair defect in the subset of XPE patients that lack DNA damage-binding activity is caused by a defect in DDB, Keeney et al. (1994) injected purified human DDB protein into XPE cells.

Specifications

• Accession Number: Q16531
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1642
• Name: Human DDB1 (aa 541-651) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 127 kDa; AA408517; damage specific DNA binding protein 1; damaged-DNA recognition protein 1; damage-specific DNA binding protein 1, 127 kDa; damage-specific DNA-binding protein 1; damage-specific DNA-binding protein, DNA repair; DDB p127 subunit; DDB1; DDBa; DNA damage-binding protein 1; DNA damage-binding protein a; DNA repair protein; HBV X-associated protein 1; p127-Ddb1; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; UV-DDB 1; UV-DDB1; XAP1; XAP-1; xeroderma pigmento; Xeroderma pigmentosum group E-complementing protein; XPCE; XPE; XPE-BF; XPE-binding factor
• Common Name: DDB1
• Gene Symbol: DDB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining