missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CCKBR Partial ORF (NP_795344.1, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000887-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16003745

  • £275.34 / 10µg

Estimated Shipment
05-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSD
Specifications

Specifications

NP_795344.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSD
RUO
CCKBR
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
887
CCKBR (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CCK-B|CCK2R|GASR
CCKBR
Yes
Videos
Documents