missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CBX2 Partial ORF (NP_116036, 66 a.a. - 165 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

£275.34 - £418.72

Specifications

Name CBX2 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.74kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16015725
View Documents
Abnova™
H00084733-Q01.25UG
25 ug £418.72
25µg View alternative products
Save Up to 
»
Estimated Shipment
03-11-2020
Please to purchase this item. Need a web account? Register with us today!
16005725
View Documents
Abnova™
H00084733-Q01.10UG
10 ug £275.34
10µg View alternative products
Save Up to 
»
Estimated Shipment
03-11-2020
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
Specifications

Specifications

CBX2 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa