missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BTN1A1 Partial ORF (NP_001723.1, 107 a.a. - 206 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000696-Q03.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16003705

  • £418.72 / 25µg

Estimated Shipment
05-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: VALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASV
Specifications

Specifications

NP_001723.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASV
RUO
BTN1A1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
696
BTN1A1 (Human) Recombinant Protein (Q03)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BT|BTN
BTN1A1
Yes
Videos
Documents