Abnova™ Human BDNF (P23560) Recombinant Protein

Used for Func, SDS-PAGE

Brand:  Abnova™ P4375.10ug

Product Code. 16151520

Description

The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq]

Sequence: MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Specifications

• Accession Number: P23560
• Formulation: Lyophilized
• Molecular Weight (g/mol): 27kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1 EU/μg
• Common Name: BDNF
• Biological Activity: The activity is determined by the dose-dependent induction of C6 cell proliferation. The expected ED50 for this effect is 1.3-2μg/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 627
• Name: BDNF (Human) Recombinant Protein
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Immunogen: MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Regulatory Status: RUO
• Gene Alias: MGC34632
• Gene Symbol: BDNF
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized