missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human B4GALT7 Partial ORF (NP_009186.1, 51 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011285-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005305

  • £275.34 / 10µg

Estimated Shipment
07-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: LSCSGDVARAVRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFN
Specifications

Specifications

NP_009186.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LSCSGDVARAVRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFN
RUO
B4GALT7
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11285
B4GALT7 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B4GAL-T7|XGALT-1|XGALT1|XGPT1|beta4Gal-T7
B4GALT7
Yes
Videos
Documents