missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ASCL1 Partial ORF (NP_004307.2, 76 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000429-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16003645

  • £275.34 / 10µg

Estimated Shipment
02-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRAL
Specifications

Specifications

NP_004307.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue
GGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRAL
RUO
ASCL1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
429
ASCL1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ASH1|HASH1|MASH1|bHLHa46
ASCL1
Yes
Videos
Documents