missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARPC5 Partial ORF (AAH57237.1, 31 a.a. - 89 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010092-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16005215

  • £275.34 / 10µg

Estimated Shipment
09-10-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISF
Specifications

Specifications

AAH57237.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.23kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISF
RUO
ARPC5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10092
ARPC5 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARC16|MGC88523|dJ127C7.3|p16-Arc
ARPC5
Yes
Videos
Documents