Abnova™ Human ALOX12P2 Full-length ORF (AAH41851.1, 1 a.a. - 256 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000245-P01.10ug

Product Code. 16101511

Description

Sequence: MVKLRKHNVLLSLDWFCKWISVQGPGTQGAAFFPCYRWVQGHGIICLPEGTARTVSDDPQNLFKKYREQELEERRWGSWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAKGLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPMLLRCTSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQCVAAPLVMLKLQPDGGLLPMVIQLQPP

Specifications

• Accession Number: AAH41851.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 55.5kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Regulatory Status: RUO
• Common Name: ALOX12P2
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 245
• Name: ALOX12P2 (Human) Recombinant Protein (P01)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: ALOX12E/MGC43625
• Gene Symbol: ALOX12P2
• Recombinant: Recombinant
• Expression System: wheat germ expression system