missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACP5 Partial ORF (AAH25414.1, 72 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

£275.34 - £418.72

Specifications

Name ACP5 (Human) Recombinant Protein (Q02)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 35.31kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16003595
View Documents
Abnova™
H00000054-Q02.10UG
10 ug £275.34
10µg View alternative products
Save Up to 
»
Estimated Shipment
02-11-2020
Please to purchase this item. Need a web account? Register with us today!
16013595
View Documents
Abnova™
H00000054-Q02.25UG
25 ug £418.72
25µg View alternative products
Save Up to 
»
Estimated Shipment
02-11-2020
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Specifications

Specifications

ACP5 (Human) Recombinant Protein (Q02)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
35.31kDa