missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ACP5 Partial ORF (AAH25414.1, 72 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000054-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16003595

  • £275.34 / 10µg

Estimated Shipment
10-11-2020

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Specifications

Specifications

AAH25414.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.31kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
RUO
ACP5
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
54
ACP5 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC117378|TRAP
ACP5
Yes
Videos
Documents