Abnova™ EIF4EBP1 (Human) Recombinant Protein

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001978-P01.10ug

Product Code. 16104441

Description

• Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

• Accession Number: AAH04459
• Name: eukaryotic translation initiation factor 4E binding protein 1
• Quality Control Testing: 125% SDS-PAGE Stained with Coomassie Blue
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Symbol: EIF4EBP1
• Protein Tag: GST

• Gene ID (Entrez): 1978
• Preparation Method: Wheat germ expression system
• Quantity: 10 μg
• Gene Alias: 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
• Species: Wheat Germ (in vitro)
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer