CD226, Mouse anti-Human, Clone: 4G8, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00010666-M04.100ug

Product Code. 16103006

Description

Sequence: VLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS

Specifications

• Antigen: CD226
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: CD226 molecule
• Gene Alias: DNAM-1/DNAM1/PTA1/TLiSA1
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA
• Clone: 4G8
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_006566
• Gene Symbols: CD226
• Immunogen: CD226 (NP_006557, 21 a.a. ∼ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 10666
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

Safety and Handling

Product Identifier

• CD226 monoclonal antibody (M04), clone 4G8

Signal Word

• Warning

Hazard Category

• Acute toxicity Category 4
• Serious eye damage/eye irritation Category 2
• Skin corrosion/irritation Category 2

Hazard Statement

• H302-Harmful if swallowed.
• H315-Causes skin irritation.
• H319-Causes serious eye irritation.

Precautionary Statement

• P102-Keep out of reach of children.
• P103-Read label before use.
• P233-Keep container tightly closed.
• P264-Wash hands thoroughly after handling.
• P270-Do not eat, drink or smoke when using this product.
• P280-Wear protective gloves/protective clothing/eye protection/face protection.
• P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
• P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
• P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
• P404-Store in a closed container.
• P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information

• MIXTURE LIST-Contains : sodium phosphate dibasic, potassium phosphate monobasic